RegulonDB RegulonDB 10.9: Amino acid Sequence
flagellar hook-filament junction protein 2 Amino Acid Sequence


Size: 317

Fasta

 

>flagellar hook-filament junction protein 2 E. coli K12. Version NC_000913.3 GI:556503834
MRFSTQMMYQQNMRGITNSQAEWMKYGEQMSTGKRVVNPSDDPIAASQAVVLSQAQAQNS
QYTLARTFATQKVSLEESVLSQVTTAIQNAQEKIVYASNGTLSDDDRASLATDIQGLRDQ
LLNLANTTDGNGRYIFAGYKTETAPFSEEKGKYVGGAESIKQQVDASRSMVIGHTGDKIF
DSITSNAVAEPDGSASETNLFAMLDSAIAALKTPVADSEADKETAAAALDKTNRGLKNSL
NNVLTVRAELGTQLNELESLDSLGSDRALGQTQQMSDLVDVDWNATISSYIMQQTALQAS
YKAFTDMQGLSLFQLSK
              
                            

Download fasta file
RegulonDB