RegulonDB RegulonDB 10.9: Amino acid Sequence
quinolinate phosphoribosyltransferase (decarboxylating) Amino Acid Sequence


Size: 297

Fasta

 

>quinolinate phosphoribosyltransferase (decarboxylating) E. coli K12. Version NC_000913.3 GI:556503834
MPPRRYNPDTRRDELLERINLDIPGAVAQALREDLGGTVDANNDITAKLLPENSRSHATV
ITRENGVFCGKRWVEEVFIQLAGDDVTIIWHVDDGDVINANQSLFELEGPSRVLLTGERT
ALNFVQTLSGVASKVRHYVELLEGTNTQLLDTRKTLPGLRSALKYAVLCGGGANHRLGLS
DAFLIKENHIIASGSVRQAVEKASWLHPDAPVEVEVENLEELDEALKAGADIIMLDNFET
EQMREAVKRTNGKALLEVSGNVTDKTLREFAETGVDFISVGALTKHVQALDLSMRFR
              
                            

Download fasta file
RegulonDB