RegulonDB RegulonDB 10.9: Amino acid Sequence
putative ATP-dependent helicase Lhr Amino Acid Sequence


Size: 1538

Fasta

 

>putative ATP-dependent helicase Lhr E. coli K12. Version NC_000913.3 GI:556503834
MADNPDPSSLLPDVFSPATRDWFLRAFKQPTAVQPQTWHVAARSEHALVIAPTGSGKTLA
AFLYALDRLFREGGEDTREAHKRKTSRILYISPIKALGTDVQRNLQIPLKGIADERRRRG
ETEVNLRVGIRTGDTPAQERSKLTRNPPDILITTPESLYLMLTSRARETLRGVETVIIDE
VHAVAGSKRGAHLALSLERLDALLHTSAQRIGLSATVRSASDVAAFLGGDRPVTVVNPPA
MRHPQIRIVVPVANMDDVSSVASGTGEDSHAGREGSIWPYIETGILDEVLRHRSTIVFTN
SRGLAEKLTARLNELYAARLQRSPSIAVDAAHFESTSGATSNRVQSSDVFIARSHHGSVS
KEQRAITEQALKSGELRCVVATSSLELGIDMGAVDLVIQVATPLSVASGLQRIGRAGHQV
GGVSKGLFFPRTRRDLVDSAVIVECMFAGRLENLTPPHNPLDVLAQQTVAAAAMDALQVD
EWYSRVRRAAPWKDLPRRVFDATLDMLSGRYPSGDFSAFRPKLVWNRETGILTARPGAQL
LAVTSGGTIPDRGMYSVLLPEGEEKAGSRRVGELDEEMVYESRVNDIITLGATSWRIQQI
TRDQVIVTPAPGRSARLPFWRGEGNGRPAELGEMIGDFLHLLADGAFFSGTIPPWLAEEN
TIANIQGLIEEQRNATGIVPGSRHLVLERCRDEIGDWRIILHSPYGRRVHEPWAVAIAGR
IHALWGADASVVASDDGIVARIPDTDGKLPDAAIFLFEPEKLLQIVREAVGSSALFAARF
RECAARALLMPGRTPGHRTPLWQQRLRASQLLEIAQGYPDFPVILETLRECLQDVYDLPA
LERLMRRLNGGEIQISDVTTTTPSPFATSLLFGYVAEFMYQSDAPLAERRASVLSLDSEL
LRNLLGQVDPGELLDPQVIRQVEEELQRLAPGRRAKGEEGLFDLLRELGPMTVEDLAQRH
TGSSEEVASYLENLLAVKRIFPAMISGQERLACMDDAARLRDALGVRLPESLPEIYLHRV
SYPLRDLFLRYLRAHALVTAEQLAHEFSLGIAIVEEQLQQLREQGLVMNLQQDIWVSDEV
FRRLRLRSLQAAREATRPVAATTYARLLLERQGVLPATDGSPALFASTSPGVYEGVDGVM
RVIEQLAGVGLPASLWESQILPARVRDYSSEMLDELLATGAVIWSGQKKLGEDDGLVALH
LQEYAAESFTPAEADQANRSALQQAIVAVLADGGAWFAQQISQRIRDKIGESVDLSALQE
ALWALVWQGVITSDIWAPLRALTRSSSNARTSTRRSHRARRGRPVYAQPVSPRVSYNTPN
LAGRWSLLQVEPLNDTERMLALAENMLDRYGIISRQAVIAENIPGGFPSMQTLCRSMEDS
GRIMRGRFVEGLGGAQFAERLTIDRLRDLATQATQTRHYTPVALSANDPANVWGNLLPWP
AHPATLVPTRRAGALVVVSGGKLLLYLAQGGKKMLVWQEKEELLAPEVFHALTTALRREP
RLRFTLTEVNDLPVRQTPMFTLLREAGFSSSPQGLDWG
              
                            

Download fasta file
RegulonDB