RegulonDB RegulonDB 10.9: Amino acid Sequence
putative electron transport protein HydN Amino Acid Sequence


Size: 175

Fasta

 

>putative electron transport protein HydN E. coli K12. Version NC_000913.3 GI:556503834
MNRFIIADASKCIGCRTCEVACVVSHQENQDCASLTPETFLPRIHVIKGVNISTATVCRQ
CEDAPCANVCPNGAISRDKGFVHVMQERCIGCKTCVVACPYGAMEVVVRPVIRNSGAGLN
VRADKAEANKCDLCNHREDGPACMAACPTHALICVDRNKLEQLSAEKRRRTALMF
              
                            

Download fasta file
RegulonDB