RegulonDB RegulonDB 10.9: Amino acid Sequence
crotonobetainyl-CoA hydratase Amino Acid Sequence


Size: 261

Fasta

 

>crotonobetainyl-CoA hydratase E. coli K12. Version NC_000913.3 GI:556503834
MSESLHLTRNGSILEITLDRPKANAIDAKTSFEMGEVFLNFRDDPQLRVAIITGAGEKFF
SAGWDLKAAAEGEAPDADFGPGGFAGLTEIFNLDKPVIAAVNGYAFGGGFELALAADFIV
CADNASFALPEAKLGIVPDSGGVLRLPKILPPAIVNEMVMTGRRMGAEEALRWGIVNRVV
SQAELMDNARELAQQLVNSAPLAIAALKEIYRTTSEMPVEEAYRYIRSGVLKHYPSVLHS
EDAIEGPLAFAEKRDPVWKGR
              
                            

Download fasta file
RegulonDB