RegulonDB RegulonDB 10.9: Amino acid Sequence
putative electron transfer flavoprotein FixA Amino Acid Sequence


Size: 256

Fasta

 

>putative electron transfer flavoprotein FixA E. coli K12. Version NC_000913.3 GI:556503834
MKIITCYKCVPDEQDIAVNNADGSLDFSKADAKISQYDLNAIEAACQLKQQAAEAQVTAL
SVGGKALTNAKGRKDVLSRGPDELIVVIDDQFEQALPQQTASALAAAAQKAGFDLILCGD
GSSDLYAQQVGLLVGEILNIPAVNGVSKIISLTADTLTVERELEDETETLSIPLPAVVAV
STDINSPQIPSMKAILGAAKKPVQVWSAADIGFNAEAAWSEQQVAAPKQRERQRIVIEGD
GEEQIAAFAENLRKVI
              
                            

Download fasta file
RegulonDB