RegulonDB RegulonDB 10.9: Amino acid Sequence
co-chaperone protein DjlA Amino Acid Sequence


Size: 271

Fasta

 

>co-chaperone protein DjlA E. coli K12. Version NC_000913.3 GI:556503834
MQYWGKIIGVAVALLMGGGFWGVVLGLLIGHMFDKARSRKMAWFANQRERQALFFATTFE
VMGHLTKSKGRVTEADIHIASQLMDRMNLHGASRTAAQNAFRVGKSDNYPLREKMRQFRS
VCFGRFDLIRMFLEIQIQAAFADGSLHPNERAVLYVIAEELGISRAQFDQFLRMMQGGAQ
FGGGYQQQTGGGNWQQAQRGPTLEDACNVLGVKPTDDATTIKRAYRKLMSEHHPDKLVAK
GLPPEMMEMAKQKAQEIQQAYELIKQQKGFK
              
                            

Download fasta file
RegulonDB