RegulonDB RegulonDB 10.8: Amino acid Sequence
N-glycosidase YbiA Amino Acid Sequence


Size: 160

Fasta

 

>N-glycosidase YbiA E. coli K12. Version NC_000913.3 GI:556503834
MPVRAQRIQHVMQDTIINFYSTSDDYGDFSNFAAWPIKVDGKTWPTSEHYFQAQKFLDEK
YREEIRRVSSPMVAARMGRDRSKPLRKNWESVKEQVMRKALRAKFEQHAELRALLLATAP
AKLVEHTENDAYWGDGGHGKGKNRLGYLLMELREQLAIEK
              
                            

Download fasta file
RegulonDB