RegulonDB RegulonDB 10.9: Amino acid Sequence
hydroxycarboxylate dehydrogenase B Amino Acid Sequence


Size: 361

Fasta

 

>hydroxycarboxylate dehydrogenase B E. coli K12. Version NC_000913.3 GI:556503834
MESGHRFDAQTLHSFIQAVFRQMGSEEQEAKLVADHLIAANLAGHDSHGIGMIPSYVRSW
SQGHLQINHHAKTVKEAGAAVTLDGDRAFGQVAAHEAMALGIEKAHQHGIAAVALHNSHH
IGRIGYWAEQCAAAGFVSIHFVSVVGIPMVAPFHGRDSRFGTNPFCVVFPRKDNFPLLLD
YATSAIAFGKTRVAWHKGVPVPPGCLIDVNGVPTTNPAVMQESPLGSLLTFAEHKGYALA
AMCEILGGALSGGKTTHQETLQTSPDAILNCMTTIIINPELFGAPDCNAQTEAFAEWVKA
SPHDDDKPILLPGEWEVNTRRERQKQGIPLDAGSWQAICDAARQIGMPEETLQAFCQQLA
S
              
                            

Download fasta file
RegulonDB