RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF493 domain-containing protein YbeD Amino Acid Sequence


Size: 87

Fasta

 

>DUF493 domain-containing protein YbeD E. coli K12. Version NC_000913.3 GI:556503834
MKTKLNELLEFPTPFTYKVMGQALPELVDQVVEVVQRHAPGDYTPTVKPSSKGNYHSVSI
TINATHIEQVETLYEELGKIDIVRMVL
              
                            

Download fasta file
RegulonDB