RegulonDB RegulonDB 10.10: Amino acid Sequence
molybdopterin synthase sulfur carrier subunit Amino Acid Sequence


Size: 81

Fasta

 

>molybdopterin synthase sulfur carrier subunit E. coli K12. Version NC_000913.3 GI:556503834
MIKVLFFAQVRELVGTDATEVAADFPTVEALRQHMAAQSDRWALALEDGKLLAAVNQTLV
SFDHPLTDGDEVAFFPPVTGG
              
                            

Download fasta file
RegulonDB