RegulonDB RegulonDB 10.10: Amino acid Sequence
protein SseB Amino Acid Sequence


Size: 258

Fasta

 

>protein SseB E. coli K12. Version NC_000913.3 GI:556503834
MSETKNELEDLLEKAATEPAHRPAFFRTLLESTVWVPGTAAQGEAVVEDSALDLQHWEKE
DGTSVIPFFTSLEALQQAVEDEQAFVVMPVRTLFEMTLGETLFLNAKLPTGKEFMPREIS
LLIGEEGNPLSSQEILEGGESLILSEVAEPPAQMIDSLTTLFKTIKPVKRAFICSIKENE
EAQPNLLIGIEADGDIEEIIQATGSVATDTLPGDEPIDICQVKKGEKGISHFITEHIAPF
YERRWGGFLRDFKQNRII
              
                            

Download fasta file
RegulonDB