RegulonDB RegulonDB 10.9: Amino acid Sequence
L-serine deaminase II Amino Acid Sequence


Size: 455

Fasta

 

>L-serine deaminase II E. coli K12. Version NC_000913.3 GI:556503834
MISVFDIFKIGIGPSSSHTVGPMKAGKQFTDDLIARNLLKDVTRVVVDVYGSLSLTGKGH
HTDIAIIMGLAGNLPDTVDIDSIPSFIQDVNTHGRLMLANGQHEVEFPVDQCMNFHADNL
SLHENGMRITALAGDKVVYSQTYYSIGGGFIVDEEHFGQQDSAPVEVPYPYSSAADLQKH
CQETGLSLSGLMMKNELALHSKEELEQHLANVWEVMRGGIERGISTEGVLPGKLRVPRRA
AALRRMLVSQDKTTTDPMAVVDWINMFALAVNEENAAGGRVVTAPTNGACGIIPAVLAYY
DKFIREVNANSLARYLLVASAIGSLYKMNASISGAEVGCQGEVGVACSMAAAGLAELLGA
SPAQVCIAAEIAMEHNLGLTCDPVAGQVQVPCIERNAIAAVKAVNAARMALRRTSEPRVC
LDKVIETMYETGKDMNAKYRETSRGGLAMKIVACD
              
                            

Download fasta file
RegulonDB