RegulonDB RegulonDB 10.10: Amino acid Sequence
L-arginine ABC transporter ATP binding subunit Amino Acid Sequence


Size: 242

Fasta

 

>L-arginine ABC transporter ATP binding subunit E. coli K12. Version NC_000913.3 GI:556503834
MSIQLNGINCFYGAHQALFDITLDCPQGETLVLLGPSGAGKSSLLRVLNLLEMPRSGTLN
IAGNHFDFTKTPSDKAIRDLRRNVGMVFQQYNLWPHLTVQQNLIEAPCRVLGLSKDQALA
RAEKLLERLRLKPYSDRYPLHLSGGQQQRVAIARALMMEPQVLLFDEPTAALDPEITAQI
VSIIRELAETNITQVIVTHEVEVARKTASRVVYMENGHIVEQGDASCFTEPQTEAFKNYL
SH
              
                            

Download fasta file
RegulonDB