RegulonDB RegulonDB 10.8: Amino acid Sequence
L-arginine ABC transporter membrane subunit ArtQ Amino Acid Sequence


Size: 238

Fasta

 

>L-arginine ABC transporter membrane subunit ArtQ E. coli K12. Version NC_000913.3 GI:556503834
MNEFFPLASAAGMTVGLAVCALIVGLALAMFFAVWESAKWRPVAWAGSALVTILRGLPEI
LVVLFIYFGSSQLLLTLSDGFTINLGFVQIPVQMDIENFDVSPFLCGVIALSLLYAAYAS
QTLRGALKAVPVGQWESGQALGLSKSAIFFRLVMPQMWRHALPGLGNQWLVLLKDTALVS
LISVNDLMLQTKSIATRTQEPFTWYIVAAAIYLVITLLSQYILKRIDLRATRFERRPS
              
                            

Download fasta file
RegulonDB