RegulonDB RegulonDB 10.9: Amino acid Sequence
putrescine ABC transporter membrane subunit PotH Amino Acid Sequence


Size: 317

Fasta

 

>putrescine ABC transporter membrane subunit PotH E. coli K12. Version NC_000913.3 GI:556503834
MSTLEPAAQSKPPGGFKLWLSQLQMKHGRKLVIALPYIWLILLFLLPFLIVFKISLAEMA
RAIPPYTELMEWADGQLSITLNLGNFLQLTDDPLYFDAYLQSLQVAAISTFCCLLIGYPL
AWAVAHSKPSTRNILLLLVILPSWTSFLIRVYAWMGILKNNGVLNNFLLWLGVIDQPLTI
LHTNLAVYIGIVYAYVPFMVLPIYTALIRIDYSLVEAALDLGARPLKTFFTVIVPLTKGG
IIAGSMLVFIPAVGEFVIPELLGGPDSIMIGRVLWQEFFNNRDWPVASAVAIIMLLLLIV
PIMWFHKHQQKSVGEHG
              
                            

Download fasta file
RegulonDB