RegulonDB RegulonDB 10.10: Amino acid Sequence
inner membrane protein MarC Amino Acid Sequence


Size: 221

Fasta

 

>inner membrane protein MarC E. coli K12. Version NC_000913.3 GI:556503834
MLDLFKAIGLGLVVLLPLANPLTTVALFLGLAGNMNSAERNRQSLMASVYVFAIMMVAYY
AGQLVMDTFGISIPGLRIAGGLIVAFIGFRMLFPQQKAIDSPEAKSKSEELEDEPSANIA
FVPLAMPSTAGPGTIAMIISSASTVRQSSTFADWVLMVAPPLIFFLVAVILWGSLRSSGA
IMRLVGKGGIEAISRLMGFLLVCMGVQFIINGILEIIKTYH
              
                            

Download fasta file
RegulonDB