RegulonDB RegulonDB 10.9: Amino acid Sequence
BOF family protein YdeI Amino Acid Sequence


Size: 130

Fasta

 

>BOF family protein YdeI E. coli K12. Version NC_000913.3 GI:556503834
MKFQAIVLASFLVMPYALADDQGGLKQDAAPPPPHAIEDGYRGTDDAKKMTVDFAKTMHD
GASVSLRGNLISHKGEDRYVFRDKSGEINVVIPAAVFDGREVQPDQMINISGSLDKKSAP
AVVRVTHLQK
              
                            

Download fasta file
RegulonDB