RegulonDB RegulonDB 10.9: Amino acid Sequence
putative pseudouridine kinase Amino Acid Sequence


Size: 313

Fasta

 

>putative pseudouridine kinase E. coli K12. Version NC_000913.3 GI:556503834
MREKDYVVIIGSANIDVAGYSHESLNYADSNPGKIKFTPGGVGRNIAQNLALLGNKAWLL
SAVGSDFYGQSLLTQTNQSGVYVDKCLIVPGENTSSYLSLLDNTGEMLVAINDMNISNAI
TAEYLAQHGEFIQRAKVIVADCNISEEALAWILDNAANVPVFVDPVSAWKCVKVRDRLNQ
IHTLKPNRLEAETLSGIALSGREDVAKVAAWFHQHGLNRLVLSMGGDGVYYSDISGESGW
SAPIKTNVINVTGAGDAMMAGLASCWVDGMPFAESVRFAQGCSSMALSCEYTNNPDLSIA
NVISLVENAECLN
              
                            

Download fasta file
RegulonDB