RegulonDB RegulonDB 10.9: Amino acid Sequence
LysR family transcriptional regulator YafC Amino Acid Sequence


Size: 304

Fasta

 

>putative LysR family transcriptional regulator YafC E. coli K12. Version NC_000913.3 GI:556503834
MKATSEELAIFVSVVESGSFSRAAEQLGQANSAVSRAVKKLEMKLGVSLLNRTTRQLSLT
EEGERYFRRVQSILQEMAAAESEIMETRNTPRGLLRIDAATPVVLHFLMPLIKPFRERYP
EVTLSLVSSETIINLIERKVDVAIRAGTLTDSSLRARPLFNSYRKIIASPDYISRYGKPE
TIDDLKQHICLGFTEPASLNTWPIARSDGQLHEVKYGLSSNSGETLKQLCLSGNGIACLS
DYMIDKEIARGELVELMADKVLPVEMPFSAVYYSDRAVSTRIRAFIDFLSEHVKTAPGGA
VREA
              
                            

Download fasta file
RegulonDB