RegulonDB RegulonDB 10.9: Amino acid Sequence
3-methyl-2-oxobutanoate hydroxymethyltransferase Amino Acid Sequence


Size: 264

Fasta

 

>3-methyl-2-oxobutanoate hydroxymethyltransferase E. coli K12. Version NC_000913.3 GI:556503834
MKPTTISLLQKYKQEKKRFATITAYDYSFAKLFADEGLNVMLVGDSLGMTVQGHDSTLPV
TVADIAYHTAAVRRGAPNCLLLADLPFMAYATPEQAFENAATVMRAGANMVKIEGGEWLV
ETVQMLTERAVPVCGHLGLTPQSVNIFGGYKVQGRGDEAGDQLLSDALALEAAGAQLLVL
ECVPVELAKRITEALAIPVIGIGAGNVTDGQILVMHDAFGITGGHIPKFAKNFLAETGDI
RAAVRQYMAEVESGVYPGEEHSFH
              
                            

Download fasta file
RegulonDB