RegulonDB RegulonDB 10.9: Amino acid Sequence
fimbrial tip-adhesin YadC Amino Acid Sequence


Size: 412

Fasta

 

>fimbrial tip-adhesin YadC E. coli K12. Version NC_000913.3 GI:556503834
MKTIFRYILFLALYSCCNTVSAYTSFIVGNNAGVDNYRGPSTAAQMTFNYTSTASNLVFY
KPTQLGPTGVKMYWSYLDTGTGGGILYCNTSGRANPGPITIENAMVYSGKDYGGHKLFNT
SVPGLYYTMLISRVWSAYDTITDIQSPGIYIGDPSNQEFFFSVTDSDLQTKGCNKADDYD
KFWAIGGIVHNITVEFYTDTNFDPTLNQQVQLSSSSNYLYSFKAYSPGTKVVDHSNHIYV
NFTLNNVKLTLPTCFTSILTGPSVNGSTVRMGEYSSGTIKNGASPVPFDISLQNCIRVRN
IETKLVTGKVGTQNTQLLGNTLTGSTAAKGVGVLIEGLATSKNPLMTLKPNDTNSVYIDY
ETEDDTSDGVYPNQGNGTSQPLHFQATLKQDGNIAIEPGEFKATSTFQVTYP
              
                            

Download fasta file
RegulonDB