RegulonDB RegulonDB 10.9: Amino acid Sequence
lipopolysaccharide transport system ATP binding protein LptB Amino Acid Sequence


Size: 241

Fasta

 

>lipopolysaccharide transport system ATP binding protein LptB E. coli K12. Version NC_000913.3 GI:556503834
MATLTAKNLAKAYKGRRVVEDVSLTVNSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGNI
IIDDDDISLLPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLQIRDDLSAEQREDRANE
LMEEFHIEHLRDSMGQSLSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKRII
EHLRDSGLGVLITDHNVRETLAVCERAYIVSQGHLIAHGTPTEILQDEHVKRVYLGEDFR
L
              
                            

Download fasta file
RegulonDB