RegulonDB RegulonDB 10.9: Amino acid Sequence
ribosome hibernation-promoting factor Amino Acid Sequence


Size: 95

Fasta

 

>ribosome hibernation-promoting factor E. coli K12. Version NC_000913.3 GI:556503834
MQLNITGNNVEITEALREFVTAKFAKLEQYFDRINQVYVVLKVEKVTHTSDATLHVNGGE
IHASAEGQDMYAAIDGLIDKLARQLTKHKDKLKQH
              
                            

Download fasta file
RegulonDB