RegulonDB RegulonDB 10.9: Amino acid Sequence
phosphotransferase system enzyme IIA(Ntr) Amino Acid Sequence


Size: 163

Fasta

 

>phosphotransferase system enzyme IIA(Ntr) E. coli K12. Version NC_000913.3 GI:556503834
MTNNDTTLQLSSVLNRECTRSRVHCQSKKRALEIISELAAKQLSLPPQVVFEAILTREKM
GSTGIGNGIAIPHGKLEEDTLRAVGVFVQLETPIAFDAIDNQPVDLLFALLVPADQTKTH
LHTLSLVAKRLADKTICRRLRAAQSDEELYQIITDTEGTPDEA
              
                            

Download fasta file
RegulonDB