RegulonDB RegulonDB 10.9: Amino acid Sequence
putative xyloside transporter YicJ Amino Acid Sequence


Size: 460

Fasta

 

>putative xyloside transporter YicJ E. coli K12. Version NC_000913.3 GI:556503834
MKSEVLSVKEKIGYGMGDAASHIIFDNVMLYMMFFYTDIFGIPAGFVGTMFLVARALDAI
SDPCMGLLADRTRSRWGKFRPWVLFGALPFGIVCVLAYSTPDLSMNGKMIYAAITYTLLT
LLYTVVNIPYCALGGVITNDPTQRISLQSWRFVLATAGGMLSTVLMMPLVNLIGGDNKPL
GFQGGIAVLSVVAFMMLAFCFFTTKERVEAPPTTTSMREDLRDIWQNDQWRIVGLLTIFN
ILAVCVRGGAMMYYVTWILGTPEVFVAFLTTYCVGNLIGSALAKPLTDWKCKVTIFWWTN
ALLAVISLAMFFVPMQASITMFVFIFVIGVLHQLVTPIQWVMMSDTVDYGEWCNGKRLTG
ISFAGTLFVLKLGLAFGGALIGWMLAYGGYDAAEKAQNSATISIIIALFTIVPAICYLLS
AIIAKRYYSLTTHNLKTVMEQLAQGKRRCQQQFTSQEVQN
              
                            

Download fasta file
RegulonDB