RegulonDB RegulonDB 11.0: Amino acid Sequence
multidrug efflux pump membrane fusion lipoprotein AcrA Amino Acid Sequence


Size: 397

Fasta

 

>multidrug efflux pump membrane fusion lipoprotein AcrA E. coli K12. Version NC_000913.3 GI:556503834
MNKNRGFTPLAVVLMLSGSLALTGCDDKQAQQGGQQMPAVGVVTVKTEPLQITTELPGRT
SAYRIAEVRPQVSGIILKRNFKEGSDIEAGVSLYQIDPATYQATYDSAKGDLAKAQAAAN
IAQLTVNRYQKLLGTQYISKQEYDQALADAQQANAAVTAAKAAVETARINLAYTKVTSPI
SGRIGKSNVTEGALVQNGQATALATVQQLDPIYVDVTQSSNDFLRLKQELANGTLKQENG
KAKVSLITSDGIKFPQDGTLEFSDVTVDQTTGSITLRAIFPNPDHTLLPGMFVRARLEEG
LNPNAILVPQQGVTRTPRGDATVLVVGADDKVETRPIVASQAIGDKWLVTEGLKAGDRVV
ISGLQKVRPGVQVKAQEVTADNNQQAASGAQPEQSKS
              
                            

Download fasta file
RegulonDB