RegulonDB RegulonDB 10.9: Amino acid Sequence
putative PTS enzyme II component GlvC Amino Acid Sequence


Size: 368

Fasta

 

>putative PTS enzyme II component GlvC E. coli K12. Version NC_000913.3 GI:556503834
MLSQIQRFGGAMFTPVLLFPFAGIVVGLAILLQNPMFVGESLTDPNSLFAQIVHIIEEGG
WTVFRNMPLIFAVGLPIGLAKQAQGRACLAVMVSFLTWNYFINAMGMTWGSYFGVDFTQD
AVAGSGLTMMAGIKTLDTSIIGAIIISGIVTALHNRLFDKKLPVFLGIFQGTSYVVIIAF
LVMIPCAWLTLLGWPKVQMGIESLQAFLRSAGALGVWVYTFLERILIPTGLHHFIYGQFI
FGPAAVEGGIQMYWAQHLQEFSLSAEPLKSLFPEGGFALHGNSKIFGAVGISLAMYFTAA
PENRVKVAGLLIPATLTAMLVGITEPLEFTFLFISPLLFAVHAVLAASMSTVMYLFGVVG
NMGGGLID
              
                            

Download fasta file
RegulonDB