RegulonDB RegulonDB 10.10: Amino acid Sequence
ABC transporter family protein YddA Amino Acid Sequence


Size: 561

Fasta

 

>ABC transporter family protein YddA E. coli K12. Version NC_000913.3 GI:556503834
MITIPITLRMLIAKYLCLLKPFWLRKNNKTSVLLIIIILAMILGVVKIQVWLNDWNNDFF
NALSQKETDKLWQLVLWFPALLGIFVLISVNKTWLIKLLTIRWREWLTDYYLNRWFADKN
YYFTQIYGEHKNTDNPDQRIAEDILLLISKTLSLSFGFIQSLSMLITFTVILWESAGTLS
FTVGGTEWNIQGYMVYTVVLIVIGGTLFTHKVGKRIRPLNVEKQRSEATFRTNLVQHNKQ
AELIALSNAESLQRQELSDNFHTIKENWHRLMNRQRWLDYWQNIYSRSLSVLPYFLLLPQ
FISGQINLGGLMKSRQAFMLVSNNLSWFIYKYDELAELAAVIDRLYEFHQLTEQRPTNKP
KNCQHAVQVADASIRTPDNKIILENLNFHVSPGKWLLLKGYSGAGKTTLLKTLSHCWPWF
KGDISSPADSWYVSQTPLIKTGLLKEIICKALPLPVDDKSLSEVLHQVGLGKLAARIHDH
DRWGDILSSGEKQRIALARLILRRPKWIFLDETTSHLEEQEAIRLLRLVREKLPTSGVIM
VTHQPGVWNLADDICDISAVL
              
                            

Download fasta file
RegulonDB