RegulonDB RegulonDB 10.10: Amino acid Sequence
putative TonB-dependent receptor YddB Amino Acid Sequence


Size: 790

Fasta

 

>putative TonB-dependent receptor E. coli K12. Version NC_000913.3 GI:556503834
MKRVLIPGVILCGADVAQAVDDKNMYMHFFEEMTVYAPVPVPVNGNTHYTSESIERLPTG
NGNISDLLRTNPAVRMDSTQSTSLNQGDIRPEKISIHGASPYQNAYLIDGISATNNLNPA
NESDASSATNISGMSQGYYLDVSLLDNVTLYDSFVPVEFGRFNGGVIDAKIKRFNADDSK
VKLGYRTTRSDWLTSHIDENNKSAFNQGSSGSTYYSPDFKKNFYTLSFNQELADNFGVTA
GLSRRQSDITRADYVSNDGIVAGRAQYKNVIDTALSKFTWFASDRFTHDLTLKYTGSSRD
YNTSTFPQSDREMGNKSYGLAWDMDTQLAWAKLRTTVGWDHISDYTRHDHDIWYTELSCT
YGDITGRCTRGGLGHISQAVDNYTFKTRLDWQKFAVGNVSHQPYFGAEYIYSDAWTERHN
QSESYVINAAGKKTNHTIYHKGKGRLGIDNYTLYMADRISWRNVSLMPGVRYDYDNYLSN
HNISPRFMTEWDIFANQTSMITAGYNRYYGGNILDMGLRDIRNSWTESVSGNKTLTRYQD
LKTPYNDELAMGLQQKIGKNVIARANYVYREAHDQISKSSRTDSATKTTITEYNNDGKTK
THSFSLSFELAEPLHIRQVDINPQIVFSYIKSKGNLSLNNGYEESNTGDNQVVYNGNLVS
YDSVPVADFNNPLKISLNMDFTHQPSGLVWANTLAWQEARKARIILGKTNAQYISEYSDY
KQYVDEKLDSSLTWDTRLSWTPQFLQQQNLTISADILNVLDSKTAVDTTNTGVATYASGR
TFWLDVSMKF
              
                            

Download fasta file
RegulonDB