RegulonDB RegulonDB 10.9: Amino acid Sequence
aspartate 1-decarboxylase proenzyme Amino Acid Sequence


Size: 126

Fasta

 

>aspartate 1-decarboxylase proenzyme E. coli K12. Version NC_000913.3 GI:556503834
MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAI
AAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEMKRTAKA
IPVQVA
              
                            

Download fasta file
RegulonDB