RegulonDB RegulonDB 10.8: Amino acid Sequence
recombination-promoting nuclease RpnC Amino Acid Sequence


Size: 300

Fasta

 

>recombination-promoting nuclease RpnC E. coli K12. Version NC_000913.3 GI:556503834
MDAPSTTPHDAVFKQFLMHAETARDFLEIHLPVELRELCDLNTLHLESGSFIEESLKGHS
TDVLYSVQMQGNPGYLHVVIEHQSKPDKKMAFRMMRYSIAAMHRHLEADHDKLPLVVPIL
FYQGEATPYPLSMCWFDMFYSPELARRVYNSPFPLVDITITPDDEIMQHRRIAILELLQK
HIRQRDLMLLLEQLVTLIDEGYTSGSQLVAMQNYMLQRGHTEQADLFYGVLRDRETGGES
MMTLAQWFEEKGIEKGIQQGRQEVSQEFAQRLLSKGMSREDVAEMANLPLAEIDKVINLI
              
                            

Download fasta file
RegulonDB