RegulonDB RegulonDB 10.9: Amino acid Sequence
putative polysaccharide deacetylase lipoprotein YadE Amino Acid Sequence


Size: 409

Fasta

 

>putative polysaccharide deacetylase lipoprotein YadE E. coli K12. Version NC_000913.3 GI:556503834
MYKQAVILLLMLFTASVSAALPARYMQTIENAAVWAQIGDKMVTVGNIRAGQIIAVEPTA
ASYYAFNFGFGKGFIDKGHLEPVQGRQKVEDGLGDLNKPLSNQNLVTWKDTPVYNAPSAG
SAPFGVLADNLRYPILHKLKDRLNQTWYQIRIGDRLAYISALDAQPDNGLSVLTYHHILR
DEENTRFRHTSTTTSVRAFNNQMAWLRDRGYATLSMVQLEGYVKNKINLPARAVVITFDD
GLKSVSRYAYPVLKQYGMKATAFIVTSRIKRHPQKWNPKSLQFMSVSELNEIRDVFDFQS
HTHFLHRVDGYRRPILLSRSEHNILFDFARSRRALAQFNPHVWYLSYPFGGFNDNAVKAA
NDAGFHLAVTTMKGKVKPGDNPLLLKRLYILRTDSLETMSRLVSNQPQG
              
                            

Download fasta file
RegulonDB