RegulonDB RegulonDB 10.9: Amino acid Sequence
Na+/K+:H+ antiporter ChaA Amino Acid Sequence


Size: 366

Fasta

 

>Na+/K+:H+ antiporter ChaA E. coli K12. Version NC_000913.3 GI:556503834
MSNAQEAVKTRHKETSLIFPVLALVVLFLWGSSQTLPVVIAINLLALIGILSSAFSVVRH
ADVLAHRLGEPYGSLILSLSVVILEVSLISALMATGDAAPTLMRDTLYSIIMIVTGGLVG
FSLLLGGRKFATQYMNLFGIKQYLIALFPLAIIVLVFPMALPAANFSTGQALLVALISAA
MYGVFLLIQTKTHQSLFVYEHEDDSDDDDPHHGKPSAHSSLWHAIWLIIHLIAVIAVTKM
NASSLETLLDSMNAPVAFTGFLVALLILSPEGLGALKAVLNNQVQRAMNLFFGSVLATIS
LTVPVVTLIAFMTGNELQFALGAPEMVVMVASLVLCHISFSTGRTNVLNGAAHLALFAAY
LMTIFA
              
                            

Download fasta file
RegulonDB