RegulonDB RegulonDB 10.8: Amino acid Sequence
putative oxidoreductase Amino Acid Sequence


Size: 252

Fasta

 

>putative oxidoreductase E. coli K12. Version NC_000913.3 GI:556503834
MHYQPKQDLLNDRIILVTGASDGIGREAAMTYARYGATVILLGRNEEKLRQVASHINEET
GRQPQWFILDLLTCTSENCQQLAQRIAVNYPRLDGVLHNAGLLGDVCPMSEQNPQVWQDV
MQVNVNATFMLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYAASKFATEGMMQVLA
DEYQQRLRVNCINPGGTRTAMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTF
DAQPGRKPGISQ
              
                            

Download fasta file
RegulonDB