RegulonDB RegulonDB 10.9: Amino acid Sequence
tRNA 2-selenouridine synthase Amino Acid Sequence


Size: 364

Fasta

 

>tRNA 2-selenouridine synthase E. coli K12. Version NC_000913.3 GI:556503834
MQERHTEQDYRALLIADTPIIDVRAPIEFEHGAMPAAINLPLMNNDERAAVGTCYKQQGS
DAALALGHKLVAGEIRQQRMDAWRAACLQNPQGILCCARGGQRSHIVQSWLHAAGIDYPL
VEGGYKALRQTAIQATIELAQKPIVLIGGCTGSGKTLLVQQQPNGVDLEGLARHRGSAFG
RTLQPQLSQASFENLLAAEMLKTDARQNLRLWVLEDESRMIGSNHLPECLRERMTQAAIA
VVEDPFEIRLERLNEEYFLRMHHDFTHAYGDEQGWQEYCEYLHHGLSAIKRRLGLQRYNE
LAARLDAALTTQLTTGSTDGHLAWLVPLLEEYYDPMYRYQLEKKAEKVVFRGEWAEVAEW
VKAR
              
                            

Download fasta file
RegulonDB