RegulonDB RegulonDB 10.9: Amino acid Sequence
PF15631 family protein YbbC Amino Acid Sequence


Size: 122

Fasta

 

>PF15631 family protein YbbC E. coli K12. Version NC_000913.3 GI:556503834
MKYSSIFSMLSFFILFACNETAVYGSDENIIFMRYVEKLHLDKYSVKNTVKTETMAIQLA
EIYVRYRYGERIAEEEKPYLITELPDSWVVEGAKLPYEVAGGVFIIEINKKNGCVLNFLH
SK
              
                            

Download fasta file
RegulonDB