RegulonDB RegulonDB 10.9: Amino acid Sequence
putative uncharacterized protein YbbD Amino Acid Sequence


Size: 162

Fasta

 

>putative uncharacterized protein YbbD E. coli K12. Version NC_000913.3 GI:556503834
MLAISSNLSKMIIFIFAIIIIVVLCVITYLYLYKDESLVSKHYINYMAIPENDGVFTWLP
DFFPHVAVDISIYTNVEDDYFFLIFP*QMMMGVGLRKH*Q*GPGNKWRKSYQRMIQIQKK
CGVNMVRYQGKGMV*TFFLLVKLMLRIIL*QILELDCLMLVQ
              
                            

Download fasta file
RegulonDB