RegulonDB RegulonDB 10.9: Amino acid Sequence
PF10964 domain-containing protein YbfG Amino Acid Sequence


Size: 216

Fasta

 

>PF10964 domain-containing protein YbfG E. coli K12. Version NC_000913.3 GI:556503834
MREMNQLVNTEDSAWPIIQNWLKDATNHTELLPVNKDLAETALYQLQVTTKSPMGALVYG
SGGLLIDNG*LRIAGSGHPRLPRDPVSWTQRPEFAGVRALPIADDVAGVIFALNGGDLGE
DTGCVYYFAPDTLNWESLEVGYSEFLQWALSGDLDTFYENVRWQQWREDVIKLSATEAFT
FYPFLWVQSEEARTRKVISLTELWEMQYQMKETFTQ
              
                            

Download fasta file
RegulonDB