RegulonDB RegulonDB 10.9: Amino acid Sequence
stress-induced alternate pyruvate formate-lyase subunit Amino Acid Sequence


Size: 127

Fasta

 

>stress-induced alternate pyruvate formate-lyase subunit E. coli K12. Version NC_000913.3 GI:556503834
MITGIQITKAANDDLLNSFWLLDSEKGEARCIVAKAGYAEDEVVAVSKLGDIEYREVPVE
VKPEVRVEGGQHLNVNVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIA
RTFTESL
              
                            

Download fasta file
RegulonDB