RegulonDB RegulonDB 10.9: Amino acid Sequence
DUF423 domain-containing inner membrane protein YgdD Amino Acid Sequence


Size: 131

Fasta

 

>DUF423 domain-containing inner membrane protein YgdD E. coli K12. Version NC_000913.3 GI:556503834
MTSRFMLIFAAISGFIFVALGAFGAHVLSKTMGAVEMGWIQTGLEYQAFHTLAILGLAVA
MQRRISIWFYWSSVFLALGTVLFSGSLYCLALSHLRLWAFVTPVGGVSFLAGWALMLVGA
IRLKRKGVSHE
              
                            

Download fasta file
RegulonDB