RegulonDB RegulonDB 10.10: Amino acid Sequence
hydrogenase maturation protein HybF Amino Acid Sequence


Size: 113

Fasta

 

>hydrogenase maturation protein HybF E. coli K12. Version NC_000913.3 GI:556503834
MHELSLCQSAVEIIQRQAEQHDVKRVTAVWLEIGALSCVEESAVRFSFEIVCHGTVAQGC
DLHIVYKPAQAWCWDCSQVVEIHQHDAQCPLCHGERLRVDTGDSLIVKSIEVE
              
                            

Download fasta file
RegulonDB