RegulonDB RegulonDB 10.10: Amino acid Sequence
hydrogenase maturation factor HybG Amino Acid Sequence


Size: 82

Fasta

 

>hydrogenase 2 accessory protein E. coli K12. Version NC_000913.3 GI:556503834
MCIGVPGQVLAVGEDIHQLAQVEVCGIKRDVNIALICEGNPADLLGQWVLVHVGFAMSII
DEDEAKATLDALRQMDYDITSA
              
                            

Download fasta file
RegulonDB