RegulonDB RegulonDB 10.9: Amino acid Sequence
broad specificity 5'(3')-nucleotidase and polyphosphatase Amino Acid Sequence


Size: 253

Fasta

 

>broad specificity 5'(3')-nucleotidase and polyphosphatase E. coli K12. Version NC_000913.3 GI:556503834
MRILLSNDDGVHAPGIQTLAKALREFADVQVVAPDRNRSGASNSLTLESSLRTFTFENGD
IAVQMGTPTDCVYLGVNALMRPRPDIVVSGINAGPNLGDDVIYSGTVAAAMEGRHLGFPA
LAVSLDGHKHYDTAAAVTCSILRALCKEPLRTGRILNINVPDLPLDQIKGIRVTRCGTRH
PADQVIPQQDPRGNTLYWIGPPGGKCDAGPGTDFAAVDEGYVSITPLHVDLTAHSAQDVV
SDWLNSVGVGTQW
              
                            

Download fasta file
RegulonDB