RegulonDB RegulonDB 10.10: Amino acid Sequence
PF02567 family protein YddE Amino Acid Sequence


Size: 297

Fasta

 

>PF02567 family protein YddE E. coli K12. Version NC_000913.3 GI:556503834
MKPQVYHVDAFTSQPFRGNSAGVVFPADNLSEAQMQLIARELGHSETAFLLHSDDSDVRI
RYFTPTVEVPICGHATVAAHYVRAKVLGLGNCTIWQTSLAGKHRVTIEKHNDDYRISLEQ
GTPGFEPPLEGETRAAIINALHLTEDDILPGLPIQVATTGHSKVMIPLKPEVDIDALSPD
LNALTAISKKIGCNGFFPFQIRPGKNETDGRMFSPAIGIVEDPVTGNANGPMGAWLVHHN
VLPHDGNVLRVKGHQGRALGRDGMIEVTVTIRDNQPEKVTISGTAVILFHAEWAIEL
              
                            

Download fasta file
RegulonDB