RegulonDB RegulonDB 11.1: Amino acid Sequence
molybdopterin-guanine dinucleotide biosynthesis adaptor protein Amino Acid Sequence


Size: 175

Fasta

 

>molybdopterin-guanine dinucleotide biosynthesis adaptor protein E. coli K12. Version NC_000913.3 GI:556503834
MAGKTMIPLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTHHDMDVDKPGKDSYEL
RKAGAAQTIVASQQRWALMTETPDEEELDLQFLASRMDTSKLDLILVEGFKHEEIAKIVL
FRDGAGHRPEELVIDRHVIAVASDVPLNLDVALLDINDVEGLADFVVEWMQKQNG
              
                            

Download fasta file
RegulonDB