RegulonDB RegulonDB 11.0: Amino acid Sequence
DUF1040 domain-containing protein YihD Amino Acid Sequence


Size: 89

Fasta

 

>DUF1040 domain-containing protein YihD E. coli K12. Version NC_000913.3 GI:556503834
MKCKRLNEVIELLQPAWQKEPDLNLLQFLQKLAKESGFDGELADLTDDILIYHLKMRDSA
KDAVIPGLQKDYEEDFKTALLRARGVIKE
              
                            

Download fasta file
RegulonDB