RegulonDB RegulonDB 10.9: Amino acid Sequence
Zn2+/Fe2+/Cd2+ exporter Amino Acid Sequence


Size: 300

Fasta

 

>Zn2+/Fe2+/Cd2+ exporter E. coli K12. Version NC_000913.3 GI:556503834
MNQSYGRLVSRAAIAATAMASLLLLIKIFAWWYTGSVSILAALVDSLVDIGASLTNLLVV
RYSLQPADDNHSFGHGKAESLAALAQSMFISGSALFLFLTGIQHLISPTPMTDPGVGVIV
TIVALICTIILVSFQRWVVRRTQSQAVRADMLHYQSDVMMNGAILLALGLSWYGWHRADA
LFALGIGIYILYSALRMGYEAVQSLLDRALPDEERQEIIDIVTSWPGVSGAHDLRTRQSG
PTRFIQIHLEMEDSLPLVQAHMVADQVEQAILRRFPGSDVIIHQDPCSVVPREGKRSMLS
              
                            

Download fasta file
RegulonDB