RegulonDB RegulonDB 10.10: Amino acid Sequence
putative lipid-binding hydrolase YiiX Amino Acid Sequence


Size: 202

Fasta

 

>putative lipid binding hydrolase E. coli K12. Version NC_000913.3 GI:556503834
MKNRLLILSLLVSVPAFAWQPQTGDIIFQISRSSQSKAIQLATHTDYSHTGMLVIRNKKP
YVFEAVGPVKYTPLKQWIAHGEKGKYVVRRVEGGLSVEQQQKLAQTAKRYLGKPYDFSFS
WSDDRQYCSEVVWKVYQNALGMRVGEQQKLKEFDLSSPQVQAKLKERYGKNIPLEETVVS
PQAVFDAPQLTTVAKEWPLFSW
              
                            

Download fasta file
RegulonDB