RegulonDB RegulonDB 10.10: Amino acid Sequence
DNA gyrase inhibitor Amino Acid Sequence


Size: 157

Fasta

 

>DNA gyrase inhibitor E. coli K12. Version NC_000913.3 GI:556503834
MNYEIKQEEKRTVAGFHLVGPWEQTVKKGFEQLMMWVDSKNIVPKEWVAVYYDNPDETPA
EKLRCDTVVTVPGYFTLPENSEGVILTEITGGQYAVAVARVVGDDFAKPWYQFFNSLLQD
SAYEMLPKPCFEVYLNNGAEDGYWDIEMYVAVQPKHH
              
                            

Download fasta file
RegulonDB